PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_13392A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 323aa    MW: 34423.8 Da    PI: 6.0681
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_13392AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-181360148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg W++eEde+lv++++ +G  +W++++++ g+ R++k+c++rw +yl
  Oropetium_20150105_13392A 13 RGLWSPEEDEKLVRYITAHGHSCWSSVPKHAGLQRCGKSCRLRWINYL 60
                               788*******************************************97 PP

2Myb_DNA-binding37.17.4e-1266102139
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 
                                rg ++++E+  ++d+++ lG++ W+ Ia++++ gRt+++
  Oropetium_20150105_13392A  66 RGTFSEQEERTIIDVHRILGNR-WAQIAKHLP-GRTDNE 102
                                899*******************.*********.****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-27463IPR009057Homeodomain-like
PROSITE profilePS5129424.237864IPR017930Myb domain
SuperFamilySSF466896.5E-2610102IPR009057Homeodomain-like
SMARTSM007172.1E-131262IPR001005SANT/Myb domain
PfamPF002499.6E-161360IPR001005SANT/Myb domain
CDDcd001675.40E-121660No hitNo description
Gene3DG3DSA:1.10.10.602.4E-1764102IPR009057Homeodomain-like
PROSITE profilePS5129410.51165113IPR017930Myb domain
SMARTSM007171.8E-565109IPR001005SANT/Myb domain
PfamPF002491.4E-1066102IPR001005SANT/Myb domain
CDDcd001674.62E-868102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLVRYITA HGHSCWSSVP KHAGLQRCGK SCRLRWINYL  60
RPDLKRGTFS EQEERTIIDV HRILGNRWAQ IAKHLPGRTD NEFHSNGAIA NGGGAATTPP  120
FTISSPTKAA FDALTVGPPP SEMMTPGLFD VPNPGVLMRQ DQATIPGGYP YQDNGHGVLM  180
SFRDQNAGLQ ASMDFMNGSS SSSSMDHAVG MQNGFSQGMP AAAFMDETAA MWAVEPGMGA  240
GMEVVQQPPP PPPVVVHPTA VMNGSGGAVT DKGLDMMDVS SVYSSVGANN AAFDLELMES  300
CDLFCSGGGG AGNAMEHLQW DC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-2613101491MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-2613101491C-Myb DNA-Binding Domain
1msf_C8e-2613101491C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0040063e-55AP004006.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1197_D06.
GenBankAP0042593e-55AP004259.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0005E02.
GenBankAP0149633e-55AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126153e-55CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957753.11e-149PREDICTED: transcription factor MYB12-like
TrEMBLK3ZU711e-149K3ZU71_SETIT; Uncharacterized protein
STRINGSi030152m1e-148(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97513545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.14e-63myb domain protein 67